PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB08G26170.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family M-type_MADS
Protein Properties Length: 344aa    MW: 38078.7 Da    PI: 4.8132
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB08G26170.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF87.29.4e-28958150
                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                  krien++nrqvtfskRrng++KKA+ELSvLCd+++a+++fs++g+l  +s
  OB08G26170.1  9 KRIENTTNRQVTFSKRRNGLIKKAYELSVLCDIDIALLMFSPSGRLSHFS 58
                  79********************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.31161IPR002100Transcription factor, MADS-box
SMARTSM004321.7E-37160IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.71E-26267IPR002100Transcription factor, MADS-box
CDDcd002655.06E-34258No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.4E-25323IPR002100Transcription factor, MADS-box
PfamPF003192.2E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004043.4E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004043.4E-253859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MGRVKLPIKR IENTTNRQVT FSKRRNGLIK KAYELSVLCD IDIALLMFSP SGRLSHFSGR  60
RGYPAYLARS SSSFLHGSPS MTFRLSSMDD HAIAHLFGSA AVFRVEDVIL RYMNLSEHDR  120
GESIQNREYL VSMLQRLKRE SDMATQLANP GALNEKIEEI QQEIYSSQQQ LQITEERLRM  180
FEPDPAAFSS TSEIDGSEKF IMELLSRVME RKNNLLSNHM APFDPTAATM QGADGNQMYV  240
NQADGLATFG GDAAMWGPDG GADPGHSIFG ASDPLIYLRD HDVYDANSQH CLGPEDQYLS  300
MEQGMVAQQE PVEASASCSY VPSDETAGTP VMAYDSNAPP ANIA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P9e-16158158Myocyte-specific enhancer factor 2B
1tqe_Q9e-16158158Myocyte-specific enhancer factor 2B
1tqe_R9e-16158158Myocyte-specific enhancer factor 2B
1tqe_S9e-16158158Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFM9565040.0FM956504.1 Oryza sativa Japonica Group mRNA for MADS62 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006659532.10.0PREDICTED: agamous-like MADS-box protein AGL104
TrEMBLJ3MU360.0J3MU36_ORYBR; Uncharacterized protein
STRINGOB08G26170.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49533360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22130.13e-59AGAMOUS-like 104